Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGN2 Rabbit pAb (APR26311N)

Product Specifications

Background

The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMGN1, the encoded protein may help maintain an open chromatin configuration around transcribable genes. The protein has also been found to have antimicrobial activity against bacteria, viruses and fungi.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HMGN2 Rabbit pAb (APR26311N) .

Synonyms

HMGN2; HMG17

Gene ID

3151

UniProt

P05204

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 9kDa Observed MW: 17kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3151

Uniprot URL

https://www.uniprot.org/uniprot/P05204

AA Sequence

MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLCN4 Rabbit pAb
E45R20277N-50 50 µL

CLCN4 Rabbit pAb

Sign In for Pricing
View Details
Complete fluidic tubing set for MARS SPFLX. Include 3x CPC03
APC SP02 3 Set/Pack

Complete fluidic tubing set for MARS SPFLX. Include 3x CPC03

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Regulator of sigma D (rsd)
MBS1122839-01 0.02 mg (E-Coli)

Recombinant Salmonella heidelberg Regulator of sigma D (rsd)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Regulator of sigma D (rsd)
MBS1122839-02 0.1 mg (E-Coli)

Recombinant Salmonella heidelberg Regulator of sigma D (rsd)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Regulator of sigma D (rsd)
MBS1122839-03 0.02 mg (Yeast)

Recombinant Salmonella heidelberg Regulator of sigma D (rsd)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg Regulator of sigma D (rsd)
MBS1122839-04 0.1 mg (Yeast)

Recombinant Salmonella heidelberg Regulator of sigma D (rsd)

Sign In for Pricing
View Details