Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B3/SAP130 Rabbit pAb (APR26302N)

Product Specifications

Background

This gene encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP) . The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF (II) 31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF (II) -containing complex) . These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SF3B3/SAP130 Rabbit pAb (APR26302N) .

Synonyms

SF3B3; RSE1; SAP130; SF3b130; STAF130

Gene ID

23450

UniProt

Q15393

Cellular Locus

Nucleus

Applications

WB (Homo sapiens) IP (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 30kDa/44kDa/135kDa Observed MW: 136kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23450

Uniprot URL

https://www.uniprot.org/uniprot/Q15393

AA Sequence

VPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FKBPL Mouse Monoclonal Antibody [Clone ID: OTI2D8]
TA502165S 30 µL

FKBPL Mouse Monoclonal Antibody [Clone ID: OTI2D8]

Ask
View Details
SLC5A1, CT (SGLT1, High Affinity Sodium Glucose Cotransporter 1, High Affinity Sodium Glucose Cotransporter, High Affinity Sodium-glucose Cotransporter, Human Na+/glucose Cotransporter 1, Na (+) /glucose Cotransporter 1, Na+/glucose Cotransporter 1, NAGT, SC5A1_HUMAN, SGLT 1, Sodium Glucose Cotransporter 1, Sodium/Glucose Cotransporter 1, Solute Carrier Family 5 (Sodium/Glucose Cotransporter) Member 1, Solute Carrier Family 5 Member 1)
303613 100 µg

SLC5A1, CT (SGLT1, High Affinity Sodium Glucose Cotransporter 1, High Affinity Sodium Glucose Cotransporter, High Affinity Sodium-glucose Cotransporter, Human Na+/glucose Cotransporter 1, Na (+) /glucose Cotransporter 1, Na+/glucose Cotransporter 1, NAGT, SC5A1_HUMAN, SGLT 1, Sodium Glucose Cotransporter 1, Sodium/Glucose Cotransporter 1, Solute Carrier Family 5 (Sodium/Glucose Cotransporter) Member 1, Solute Carrier Family 5 Member 1)

Ask
View Details
Recombinant Escherichia coli O157:H7 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA), partial
MBS7056640 Inquire

Recombinant Escherichia coli O157:H7 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA), partial

Ask
View Details
CecA (Cecropin A) ELISA Kit
MBS2501030-01 24 Tests (Limit 1)

CecA (Cecropin A) ELISA Kit

Ask
View Details
CecA (Cecropin A) ELISA Kit
MBS2501030-02 48 Tests

CecA (Cecropin A) ELISA Kit

Ask
View Details
CecA (Cecropin A) ELISA Kit
MBS2501030-03 96 Tests

CecA (Cecropin A) ELISA Kit

Ask
View Details