Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pumilio 1 Rabbit pAb (APR26274N)

Product Specifications

Background

This gene encodes a member of the PUF family, evolutionarily conserved RNA-binding proteins related to the Pumilio proteins of Drosophila and the fem-3 mRNA binding factor proteins of C. elegans. The encoded protein contains a sequence-specific RNA binding domain comprised of eight repeats and N- and C-terminal flanking regions, and serves as a translational regulator of specific mRNAs by binding to their 3' untranslated regions. The evolutionarily conserved function of the encoded protein in invertebrates and lower vertebrates suggests that the human protein may be involved in translational regulation of embryogenesis, and cell development and differentiation. Alternatively spliced transcript variants encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Pumilio 1 Rabbit pAb (APR26274N) .

Synonyms

PUM1; HSPUM; PUMH; PUMH1; PUML1

Gene ID

9698

UniProt

Q14671

Cellular Locus

Cytoplasm, Cytoplasmic granule, P-body

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 119kDa/124kDa/126kDa Observed MW: 135kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9698

Uniprot URL

https://www.uniprot.org/uniprot/Q14671

AA Sequence

MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVMDKTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL4R sgRNA CRISPR Lentivector (Human) (Target 3)
K1076104 1.0 µg DNA

IL4R sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Zearalenone GQT Strip Test
ZKC0059 96 Tests

Zearalenone GQT Strip Test

Sign In for Pricing
View Details
SOX21 (Transcription Factor SOX-21, SOX-A, SOX25, SOXA) (PE)
133720-PE 100 µL

SOX21 (Transcription Factor SOX-21, SOX-A, SOX25, SOXA) (PE)

Sign In for Pricing
View Details
AIRE, ID (AIRE, APECED, Autoimmune regulator, Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein) (MaxLight 650)
MBS6272462-01 0.1 mL

AIRE, ID (AIRE, APECED, Autoimmune regulator, Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein) (MaxLight 650)

Sign In for Pricing
View Details
AIRE, ID (AIRE, APECED, Autoimmune regulator, Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein) (MaxLight 650)
MBS6272462-02 5x 0.1 mL

AIRE, ID (AIRE, APECED, Autoimmune regulator, Autoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Polyclonal GBP2 Antibody [mFluor Violet 610 SE]
NBP3-00230MFV610 0.1 mL

Rabbit Polyclonal GBP2 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details