Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pumilio 1 Rabbit pAb (APR26274N)

Product Specifications

Background

This gene encodes a member of the PUF family, evolutionarily conserved RNA-binding proteins related to the Pumilio proteins of Drosophila and the fem-3 mRNA binding factor proteins of C. elegans. The encoded protein contains a sequence-specific RNA binding domain comprised of eight repeats and N- and C-terminal flanking regions, and serves as a translational regulator of specific mRNAs by binding to their 3' untranslated regions. The evolutionarily conserved function of the encoded protein in invertebrates and lower vertebrates suggests that the human protein may be involved in translational regulation of embryogenesis, and cell development and differentiation. Alternatively spliced transcript variants encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Pumilio 1 Rabbit pAb (APR26274N) .

Synonyms

PUM1; HSPUM; PUMH; PUMH1; PUML1

Gene ID

9698

UniProt

Q14671

Cellular Locus

Cytoplasm, Cytoplasmic granule, P-body

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 119kDa/124kDa/126kDa Observed MW: 135kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9698

Uniprot URL

https://www.uniprot.org/uniprot/Q14671

AA Sequence

MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVMDKTN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Murashige & Skoog Basal Salt Mixture w/ Vitamins, van der Salm Modification
B2023200 1 L

Murashige & Skoog Basal Salt Mixture w/ Vitamins, van der Salm Modification

Sign In for Pricing
View Details
Frozen Tissue Sections, Neurovascular bundle
CS626725 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
Thymidylate Synthase Antibody Cocktail
V3164IHC-7ML 7 mL

Thymidylate Synthase Antibody Cocktail

Sign In for Pricing
View Details
MCIDAS Antibody
A52539-50UG 50 µg

MCIDAS Antibody

Sign In for Pricing
View Details
CDK20 3'UTR GFP Stable Cell Line
TU054077 1.0 mL

CDK20 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RIP3, NT (Receptor Interacting Protein 3, Receptor Interacting Serine Threonine Kinase 3, Receptor Interacting Serine/Threonine Protein Kinase 3, Receptor-interacting Protein 3, Receptor-interacting Serine/Threonine-protein Kinase 3, RIP 3, RIP Like Protein Kinase 3, RIP-3, RIP-like Protein Kinase 3, RIPK 3, RIPK3, RIPK3_HUMAN)
303577 100 µg

RIP3, NT (Receptor Interacting Protein 3, Receptor Interacting Serine Threonine Kinase 3, Receptor Interacting Serine/Threonine Protein Kinase 3, Receptor-interacting Protein 3, Receptor-interacting Serine/Threonine-protein Kinase 3, RIP 3, RIP Like Protein Kinase 3, RIP-3, RIP-like Protein Kinase 3, RIPK 3, RIPK3, RIPK3_HUMAN)

Sign In for Pricing
View Details