Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIAL1 Rabbit pAb (APR26262N)

Product Specifications

Background

The protein encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TIAL1 Rabbit pAb (APR26262N) .

Synonyms

TIAL1; TCBP; TIAR

Gene ID

7073

UniProt

Q01085

Cellular Locus

Cytoplasm, Cytoplasmic granule, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 41kDa/43kDa Observed MW: 47kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7073

Uniprot URL

https://www.uniprot.org/uniprot/Q01085

AA Sequence

EGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal Siglec-2/CD22 Antibody (pinatuzumab) [Janelia Fluor 635]
NBP3-28024JF635 0.1 mL

Human Monoclonal Siglec-2/CD22 Antibody (pinatuzumab) [Janelia Fluor 635]

Sign In for Pricing
View Details
MAPKAPK5 (MAP Kinase-Activated Protein Kinase 5, Mitogen-Activated Protein Kinase-Activated Protein Kinase 5)
485421 100 µL

MAPKAPK5 (MAP Kinase-Activated Protein Kinase 5, Mitogen-Activated Protein Kinase-Activated Protein Kinase 5)

Sign In for Pricing
View Details
Mouse IL-27/IL-35 EBI3 Subunit APC MAb (Clone 355022)
IC18341A 100 Tests

Mouse IL-27/IL-35 EBI3 Subunit APC MAb (Clone 355022)

Sign In for Pricing
View Details
Guinea Pig alpha Lactalbumin ELISA Kit
MBS730318-01 48 Well

Guinea Pig alpha Lactalbumin ELISA Kit

Sign In for Pricing
View Details
Guinea Pig alpha Lactalbumin ELISA Kit
MBS730318-02 96 Well

Guinea Pig alpha Lactalbumin ELISA Kit

Sign In for Pricing
View Details
Guinea Pig alpha Lactalbumin ELISA Kit
MBS730318-03 5x 96 Well

Guinea Pig alpha Lactalbumin ELISA Kit

Sign In for Pricing
View Details