Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFRS9 Rabbit pAb (APR26261N)

Product Specifications

Background

The protein encoded by this gene is a member of the serine/arginine (SR) -rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two pseudogenes, one on chromosome 15 and the other on chromosome 21, have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SFRS9 Rabbit pAb (APR26261N) .

Synonyms

SRSF9; SFRS9; SRp30c

Gene ID

8683

UniProt

Q13242

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa Observed MW: 26kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8683

Uniprot URL

https://www.uniprot.org/uniprot/Q13242

AA Sequence

MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKS1B, ID (ANKS1B, Ankyrin repeat and sterile alpha motif domain-containing protein 1B, Amyloid-beta protein intracellular domain-associated protein 1, E2A-PBX1-associated protein) (AP) discontinued
031907-AP 200 µL

ANKS1B, ID (ANKS1B, Ankyrin repeat and sterile alpha motif domain-containing protein 1B, Amyloid-beta protein intracellular domain-associated protein 1, E2A-PBX1-associated protein) (AP) discontinued

Sign In for Pricing
View Details
Mouse MBP (Myelin Basic Protein) ELISA Kit
EM1202 96 Tests

Mouse MBP (Myelin Basic Protein) ELISA Kit

Sign In for Pricing
View Details
Human Factor V (Factor 5) Antibody (Biotin Conjugate)
51291-05021 150 µg

Human Factor V (Factor 5) Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
RPL9P33 3'UTR Lenti-reporter-Luc Vector
41956081 1.0 µg

RPL9P33 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Lentiviral mouse Tmem74 shRNA (UAS) - Lentiviral mouse Tmem74 shRNA (UAS, iRFP) plasmid
GTR15208288 1 Vial

Lentiviral mouse Tmem74 shRNA (UAS) - Lentiviral mouse Tmem74 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Chicken prostaglandin (PG) ELISA Kit
MBS2605488-01 48 Well

Chicken prostaglandin (PG) ELISA Kit

Sign In for Pricing
View Details