Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP4 Rabbit pAb (APR26201N)

Product Specifications

Background

The protein encoded by this gene is a major non-neuronal microtubule-associated protein. This protein contains a domain similar to the microtubule-binding domains of neuronal microtubule-associated protein (MAP2) and microtubule-associated protein tau (MAPT/TAU) . This protein promotes microtubule assembly, and has been shown to counteract destabilization of interphase microtubule catastrophe promotion. Cyclin B was found to interact with this protein, which targets cell division cycle 2 (CDC2) kinase to microtubules. The phosphorylation of this protein affects microtubule properties and cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MAP4 Rabbit pAb (APR26201N) .

Synonyms

MAP4

Gene ID

4134

UniProt

P27816

Cellular Locus

Cytoplasm, cytoskeleton

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa/58kDa/85kDa/91kDa/102kDa/119kDa/121kDa Observed MW: 200kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4134

Uniprot URL

https://www.uniprot.org/uniprot/P27816

AA Sequence

TENIKHQPGGGRAKVEKKTEAAATTRKPESNAVTKTAGPIASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPTSASGLNGHPTLSGGGDQREAQTLDSQIQETSI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rdh12 shRNA (UAS) - Lentiviral mouse Rdh12 shRNA (UAS, GFP) (100)
GTR15264873 1 Vial

Lentiviral mouse Rdh12 shRNA (UAS) - Lentiviral mouse Rdh12 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
GGA1 (Golgi Associated, gamma Adaptin Ear Containing, ARF Binding Protein 1) (HRP)
MBS6179530-01 0.1 mL

GGA1 (Golgi Associated, gamma Adaptin Ear Containing, ARF Binding Protein 1) (HRP)

Sign In for Pricing
View Details
GGA1 (Golgi Associated, gamma Adaptin Ear Containing, ARF Binding Protein 1) (HRP)
MBS6179530-02 5x 0.1 mL

GGA1 (Golgi Associated, gamma Adaptin Ear Containing, ARF Binding Protein 1) (HRP)

Sign In for Pricing
View Details
MARCKS, phosphorylated (S163) discontinued
341524-01 100 µL

MARCKS, phosphorylated (S163) discontinued

Sign In for Pricing
View Details
MARCKS, phosphorylated (S163) discontinued
341524-02 200 µL

MARCKS, phosphorylated (S163) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal NCAM-1/CD56 Antibody (735) [Alexa Fluor 488]
NBP2-52669AF488 0.1 mL

Rabbit Monoclonal NCAM-1/CD56 Antibody (735) [Alexa Fluor 488]

Sign In for Pricing
View Details