Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEK Rabbit pAb (APR26198N)

Product Specifications

Background

This gene encodes a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. Chromosomal aberrations involving this region, increased expression of this gene, and the presence of antibodies against this protein are all associated with various diseases. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DEK Rabbit pAb (APR26198N) .

Synonyms

DEK; D6S231E

Gene ID

7913

UniProt

P35659

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 38kDa/42kDa Observed MW: 43kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7913

Uniprot URL

https://www.uniprot.org/uniprot/P35659

AA Sequence

KSLIVEGKREKKKVERLTMQVSSLQREPFTIAQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPGTVSSLKKNVGQFSGFPFEKGSVQYKKKEEMLKKFRNAMLKSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COLQ (NM_005677) Human Over-expression Lysate
LY401731 100 µg

COLQ (NM_005677) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS620458 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF640R conjugate, 0.1mg/mL
BNC401505-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,4,5-Trichloronitrobenzene- 13C6
TRC-T774316-2.5MG 2.5 mg

2,4,5-Trichloronitrobenzene- 13C6

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon: right
CP565649 150 µg

Tissue Protein Lysate, Colon: right

Sign In for Pricing
View Details
HNF 4 alpha (HNF4A) (NM_001030004) Human Recombinant Protein
TP316588M 100 µg

HNF 4 alpha (HNF4A) (NM_001030004) Human Recombinant Protein

Sign In for Pricing
View Details