Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ILF2 Rabbit pAb (APR26180N)

Product Specifications

Background

The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa protein (NF45, ILF2) forms a complex with the 90 kDa interleukin enhancer-binding factor 3 (NF90, ILF3), and this complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm, to repair DNA breaks by nonhomologous end joining, and to negatively regulate the microRNA processing pathway. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ILF2 Rabbit pAb (APR26180N) .

Synonyms

ILF2; NF45; PRO3063

Gene ID

3608

UniProt

Q12905

Cellular Locus

Cytoplasm, Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 43kDa Observed MW: 50kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3608

Uniprot URL

https://www.uniprot.org/uniprot/Q12905

AA Sequence

MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Primer Panel
HPP6017D 200x 96 reactions in matrix tubes

Primer Panel

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (rC3e/2479), CF568 conjugate, 0.1mg/mL
BNC683790-500 1x 500 µL

CD3e (T-Cell Marker) (rC3e/2479), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-Hsp27 (S78) Recombinant Rabbit Monoclonal Antibody [JJ08-70]
ET1701-19 100 µL

Phospho-Hsp27 (S78) Recombinant Rabbit Monoclonal Antibody [JJ08-70]

Sign In for Pricing
View Details
DNAJB9 Rabbit Polyclonal Antibody
TA369645 100 µL

DNAJB9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RH 1788
TRC-R315765-25MG 25 mg

RH 1788

Sign In for Pricing
View Details
CD79a Rabbit Polyclonal Antibody
R1204-4 100 µL

CD79a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details