Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B2 Rabbit pAb (APR26175N)

Product Specifications

Background

This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP) . The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SF3B2 Rabbit pAb (APR26175N) .

Synonyms

SF3B2; Cus1; SAP145; SF3B145; SF3b1; SF3b150

Gene ID

10992

UniProt

Q13435

Cellular Locus

Nucleus

Applications

WB (293T)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 100kDa Observed MW: 140kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10992

Uniprot URL

https://www.uniprot.org/uniprot/Q13435

AA Sequence

SLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRD2 Polyclonal Antibody, APC-Cy7 Conjugated
bs-12888R-APC-Cy7 100 µL

BRD2 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
pOTB7-HSPB6 Plasmid
PVT26739 2 µg

pOTB7-HSPB6 Plasmid

Sign In for Pricing
View Details
Tmbim1 (NM_027154) Mouse Tagged ORF Clone
MR218584 10 µg

Tmbim1 (NM_027154) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
DUT Recombinant Antibody, FITC Conjugated
bsm-62811R-FITC-01 20 µL

DUT Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
DUT Recombinant Antibody, FITC Conjugated
bsm-62811R-FITC-02 100 µL

DUT Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
CD82 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0404206 1.0 µg DNA

CD82 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details