SF3B2 Rabbit pAb (APR26175N)
Product Specifications
Background
This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP) . The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus.
Overview
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SF3B2 Rabbit pAb (APR26175N) .
Synonyms
SF3B2; Cus1; SAP145; SF3B145; SF3b1; SF3b150
Gene ID
10992
UniProt
Q13435
Cellular Locus
Nucleus
Applications
WB (293T)
Dilution
WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Form
Liquid
Buffer
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Molecular Weight
Calculated MW: 100kDa Observed MW: 140kDa
Storage Conditions
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
Gene ID URL
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10992
Uniprot URL
https://www.uniprot.org/uniprot/Q13435
AA Sequence
SLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
222524-01 50 µL
ERCC6L (ATP Dependent Helicase ERCC6 like, ATP-Dependent Helicase ERCC6-like, DNA excision Repair Protein ERCC 6 like, DNA excision Repair Protein ERCC-6-like, ERC6L_HUMAN, ERCC 6L, ERCC6L, Excision Repair cross Complementing rodent Repair deficiency complementation group 6 like, Excision Repair Protein ERCC6 like, FLJ20105, MGC131695, PICH, Plk1 interacting Checkpoint Helicase, PLK1-interacting Checkpoint Helicase, SNF2/RAD54 Family Protein, Tumor Antigen BJ HCC 15, Tumor Antigen BJ-HCC-15) discontinued
Sign In for Pricing
View Details 222524-02 100 µL
ERCC6L (ATP Dependent Helicase ERCC6 like, ATP-Dependent Helicase ERCC6-like, DNA excision Repair Protein ERCC 6 like, DNA excision Repair Protein ERCC-6-like, ERC6L_HUMAN, ERCC 6L, ERCC6L, Excision Repair cross Complementing rodent Repair deficiency complementation group 6 like, Excision Repair Protein ERCC6 like, FLJ20105, MGC131695, PICH, Plk1 interacting Checkpoint Helicase, PLK1-interacting Checkpoint Helicase, SNF2/RAD54 Family Protein, Tumor Antigen BJ HCC 15, Tumor Antigen BJ-HCC-15) discontinued
Sign In for Pricing
View Details 
A05402-4-Fluoro647 100 µg/Vial
Anti-HSPA6 Antibody Picoband® Fluoro647 Conjugated
Sign In for Pricing
View Details