Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUV39H2 Rabbit pAb (APR26162N)

Product Specifications

Background

Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5 proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as cell cycle regulation, transcriptional repression and regulation of telomere length. May participate in regulation of higher-order chromatin organization during spermatogenesis. Recruited by the large PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1, contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 'Lys-9' trimethylation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SUV39H2 Rabbit pAb (APR26162N) .

Synonyms

SUV39H2; KMT1B

Gene ID

79723

UniProt

Q9H5I1

Cellular Locus

Chromosome, Nucleus, centromere

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200 ChIP 1:20 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/39kDa/46kDa Observed MW: 50KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79723

Uniprot URL

https://www.uniprot.org/uniprot/Q9H5I1

AA Sequence

CCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEAF1 Rabbit Polyclonal Antibody (HRP)
orb2127371 100 µL

DEAF1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Pms2 (NM_008886) Mouse Tagged Lenti ORF Clone
MR225383L4 10 µg

Pms2 (NM_008886) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Dengue virus DENV-2 (strain New Guinea C) NS5A/Nonstructural protein 5A Polyclonal Antibody
MBS2563739-01 0.1 mL

Anti-Dengue virus DENV-2 (strain New Guinea C) NS5A/Nonstructural protein 5A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Dengue virus DENV-2 (strain New Guinea C) NS5A/Nonstructural protein 5A Polyclonal Antibody
MBS2563739-02 0.2 mL

Anti-Dengue virus DENV-2 (strain New Guinea C) NS5A/Nonstructural protein 5A Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Dengue virus DENV-2 (strain New Guinea C) NS5A/Nonstructural protein 5A Polyclonal Antibody
MBS2563739-03 5x 0.2 mL

Anti-Dengue virus DENV-2 (strain New Guinea C) NS5A/Nonstructural protein 5A Polyclonal Antibody

Sign In for Pricing
View Details
pCMV-SPORT6-RAB7B Plasmid
PVT13517 2 µg

pCMV-SPORT6-RAB7B Plasmid

Sign In for Pricing
View Details