Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLR10 Rabbit pAb (APR26159N)

Product Specifications

Background

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is most highly expressed in lymphoid tissues such as spleen, lymph node, thymus, and tonsil. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TLR10 Rabbit pAb (APR26159N) .

Synonyms

TLR10; CD290

Gene ID

81793

UniProt

Q9BXR5

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 94kDa Observed MW: 95kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=81793

Uniprot URL

https://www.uniprot.org/uniprot/Q9BXR5

AA Sequence

DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMUB2 (NM_001076674) Human Over-expression Lysate
LY421354 100 µg

TMUB2 (NM_001076674) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant ACSS2 Antibody
RC-4209-01 50 μL

Recombinant ACSS2 Antibody

Sign In for Pricing
View Details
Recombinant ACSS2 Antibody
RC-4209-02 100 µL

Recombinant ACSS2 Antibody

Sign In for Pricing
View Details
Recombinant ACSS2 Antibody
RC-4209-03 1 mL

Recombinant ACSS2 Antibody

Sign In for Pricing
View Details
Human TIP49A (RUVBL1) activation kit by CRISPRa
GA105697 1 Kit

Human TIP49A (RUVBL1) activation kit by CRISPRa

Sign In for Pricing
View Details
Fluorescein DHPE
23304-AAT 5 mg

Fluorescein DHPE

Sign In for Pricing
View Details