Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAB2 Rabbit pAb (APR26137N)

Product Specifications

Background

This gene encodes a member of the family of NGFI-A binding (NAB) proteins, which function in the nucleus to repress transcription induced by some members of the EGR (early growth response) family of transactivators. NAB proteins can homo- or hetero-multimerize with other EGR or NAB proteins through a conserved N-terminal domain, and repress transcription through two partially redundant C-terminal domains. Transcriptional repression by the encoded protein is mediated in part by interactions with the nucleosome remodeling and deactylase (NuRD) complex. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NAB2 Rabbit pAb (APR26137N) .

Synonyms

NAB2; MADER

Gene ID

4665

UniProt

Q15742

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa/49kDa/56kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4665

Uniprot URL

https://www.uniprot.org/uniprot/Q15742

AA Sequence

MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CTF1 (Biotin)
559570-01 50 µg

CTF1 (Biotin)

Ask
View Details
CTF1 (Biotin)
559570-02 100 µg

CTF1 (Biotin)

Ask
View Details
LMO2 CRISPR/Cas9 KO Plasmid (m)
sc-421447 20 µg

LMO2 CRISPR/Cas9 KO Plasmid (m)

Ask
View Details
TASP1 antibody
FNab08504 100 µg

TASP1 antibody

Ask
View Details
AMPK alpha1/2, phosphorylated (T183/172) (5'-AMP-Activated Protein Kinase Catalytic Subunit alpha-1, AMPK Subunit alpha-1, Acetyl-CoA Carboxylase Kinase, ACACA Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase, HMGCR Kinase, au-Protein Kinase PRKAA1, PRKAA1, AMPK1, 5'-AMP-Activated Protein Kinase Catalytic Subunit alpha-2, AMPK Subunit alpha-2, Acetyl-CoA Carboxylase Kinase, ACACA Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase, HMGCR Kinase, PRKAA2, AMPK, AMPK2) discontinued
220723-01 50 µL

AMPK alpha1/2, phosphorylated (T183/172) (5'-AMP-Activated Protein Kinase Catalytic Subunit alpha-1, AMPK Subunit alpha-1, Acetyl-CoA Carboxylase Kinase, ACACA Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase, HMGCR Kinase, au-Protein Kinase PRKAA1, PRKAA1, AMPK1, 5'-AMP-Activated Protein Kinase Catalytic Subunit alpha-2, AMPK Subunit alpha-2, Acetyl-CoA Carboxylase Kinase, ACACA Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase, HMGCR Kinase, PRKAA2, AMPK, AMPK2) discontinued

Ask
View Details
AMPK alpha1/2, phosphorylated (T183/172) (5'-AMP-Activated Protein Kinase Catalytic Subunit alpha-1, AMPK Subunit alpha-1, Acetyl-CoA Carboxylase Kinase, ACACA Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase, HMGCR Kinase, au-Protein Kinase PRKAA1, PRKAA1, AMPK1, 5'-AMP-Activated Protein Kinase Catalytic Subunit alpha-2, AMPK Subunit alpha-2, Acetyl-CoA Carboxylase Kinase, ACACA Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase, HMGCR Kinase, PRKAA2, AMPK, AMPK2) discontinued
220723-02 100 µL

AMPK alpha1/2, phosphorylated (T183/172) (5'-AMP-Activated Protein Kinase Catalytic Subunit alpha-1, AMPK Subunit alpha-1, Acetyl-CoA Carboxylase Kinase, ACACA Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase, HMGCR Kinase, au-Protein Kinase PRKAA1, PRKAA1, AMPK1, 5'-AMP-Activated Protein Kinase Catalytic Subunit alpha-2, AMPK Subunit alpha-2, Acetyl-CoA Carboxylase Kinase, ACACA Kinase, Hydroxymethylglutaryl-CoA Reductase Kinase, HMGCR Kinase, PRKAA2, AMPK, AMPK2) discontinued

Ask
View Details