Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL1A2 Rabbit pAb (APR26103N)

Product Specifications

Background

This gene encodes the pro-alpha2 chain of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIB, recessive Ehlers-Danlos syndrome Classical type, idiopathic osteoporosis, and atypical Marfan syndrome. Symptoms associated with mutations in this gene, however, tend to be less severe than mutations in the gene for the alpha1 chain of type I collagen (COL1A1) reflecting the different role of alpha2 chains in matrix integrity. Three transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COL1A2 Rabbit pAb (APR26103N) .

Synonyms

COL1A2; OI4

Gene ID

1278

UniProt

P08123

Cellular Locus

Secreted, extracellular matrix, extracellular space

Applications

IHC (Mus musculus) WB (Mus musculus, Homo sapiens, Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:25 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 129kDa Observed MW: 129KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1278

Uniprot URL

https://www.uniprot.org/uniprot/P08123

AA Sequence

PTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQGGKGEQGPPGPPGFQGLPGPSGPAGEVGKPGERGLHGEFGLPGPAGPRGERGPPGESGAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1F10 Human His
OM296439-01 20 µg

IL1F10 Human His

Sign In for Pricing
View Details
IL1F10 Human His
OM296439-02 5 µg

IL1F10 Human His

Sign In for Pricing
View Details
IL1F10 Human His
OM296439-03 1 mg

IL1F10 Human His

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2545), CF568 conjugate, 0.1mg/mL
BNC682545-100 1x 100 µL

CD73 (Immuno-Oncology Target) (NT5E/2545), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Wfdc9 Mouse Gene Knockout Kit (CRISPR)
KN519422 1 Kit

Wfdc9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS631497 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details