Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF7 Rabbit pAb (APR26101N)

Product Specifications

Background

SLAM family member 7 (SLAMF7), also known as CRACC, CD319, CD2-like receptor-activating cytotoxic cells, and CS1, is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. SLAMF7 is expressed on the surface of NK cells, CD8+ T cells, activated B cells, and mature dendritic cells but not in promyelocytic, B-cell lines, or T-cell lines. In human NK cells, activated SLAMF7 transmits signals following association with the adaptor protein EAT-2 . In the absence of EAT-2, SLAMF7 potently inhibited natural killer cell function. It was also inhibitory in T cells, which are typically devoid of EAT-2. Thus, SLAMF7 can exert activating or inhibitory influences on cells of the immune system depending on cellular context and the availability of effector proteins.

Synonyms

SLAMF7; 19A; CD319; CRACC; CS1

Gene ID

57823

UniProt

Q9NQ25

Cellular Locus

Membrane, Single-pass type I membrane protein

Applications

WB (Mus musculus) IF (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa/21kDa/22kDa/25kDa/32kDa/37kDa Observed MW: 25-80KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLAMF7 Rabbit pAb (APR26101N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57823

Uniprot URL

https://www.uniprot.org/uniprot/Q9NQ25

AA Sequence

SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MycoBlue Mycoplasma Detector
D101-02 50 Reactions

MycoBlue Mycoplasma Detector

Ask
View Details
Ron (E8M4A) Rabbit Monoclonal Antibody
CST 59840T 20 µL

Ron (E8M4A) Rabbit Monoclonal Antibody

Ask
View Details
Recombinant Human RalB Protein
NBP1-50923-0.05mg 0.05 mg

Recombinant Human RalB Protein

Ask
View Details
TNFRSF10D, CT (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (AP)
MBS6356900-01 0.2 mL

TNFRSF10D, CT (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (AP)

Ask
View Details
TNFRSF10D, CT (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (AP)
MBS6356900-02 5x 0.2 mL

TNFRSF10D, CT (TNFRSF10D, DCR2, TRAILR4, TRUNDD, Tumor necrosis factor receptor superfamily member 10D, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAIL receptor with a truncated death domain, CD264) (AP)

Ask
View Details