Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

53BP1 Rabbit pAb (APR26077N)

Product Specifications

Background

Double-strand break (DSB repair protein involved in response to DNA damage, telomere dynamics and class-switch recombination (CSR during antibody genesis. Plays a key role in the repair of double-strand DNA breaks (DSBs in response to DNA damage by promoting non-homologous end joining (NHEJ-mediated repair of DSBs and specifically counteracting the function of the homologous recombination (HR repair protein BRCA1. In response to DSBs, phosphorylation by ATM promotes interaction with RIF1 and dissociation from NUDT16L1/TIRR, leading to recruitment to DSBs sites. Recruited to DSBs sites by recognizing and binding histone H2A monoubiquitinated at 'Lys-15' (H2AK15Ub and histone H4 dimethylated at 'Lys-20' (H4K20me2, two histone marks that are present at DSBs sites. Required for immunoglobulin class-switch recombination (CSR during antibody genesis, a process that involves the generation of DNA DSBs. Participates in the repair and the orientation of the broken DNA ends during CSR (By similarity. In contrast, it is not required for classic NHEJ and V (DJ recombination (By similarity. Promotes NHEJ of dysfunctional telomeres via interaction with PAXIP1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality 53BP1 Rabbit pAb (APR26077N) .

Synonyms

TP53BP1; 53BP1; TDRD30; TP53; p202; p53BP1

Gene ID

7158

UniProt

Q12888

Cellular Locus

Chromosome, Nucleus, centromere, kinetochore

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 213kDa/214kDa Observed MW: 255kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7158

Uniprot URL

https://www.uniprot.org/uniprot/Q12888

AA Sequence

SSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LDLR Protein (His Tag)
PKSH033435-01 10 µg

Recombinant Human LDLR Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LDLR Protein (His Tag)
PKSH033435-02 50 µg

Recombinant Human LDLR Protein (His Tag)

Sign In for Pricing
View Details
Tissue Total RNA, Lymph node
CR562200 5 µg

Tissue Total RNA, Lymph node

Sign In for Pricing
View Details
Trf Mouse Gene Knockout Kit (CRISPR)
KN518170 1 Kit

Trf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Clothianidin
TRC-C588500-10G 10 g

Clothianidin

Sign In for Pricing
View Details
Phenylbutazone-13C12
TRC-P319571-5MG 5 mg

Phenylbutazone-13C12

Sign In for Pricing
View Details