Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD155/PVR Rabbit pAb (APR26073N)

Product Specifications

Background

The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the dynein light chain Tctex-1/DYNLT1. The gene is specific to the primate lineage, and serves as a cellular receptor for poliovirus in the first step of poliovirus replication. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD155/PVR Rabbit pAb (APR26073N) .

Synonyms

PVR; CD155; HVED; NECL5; Necl-5; PVS; TAGE4

Gene ID

5817

UniProt

P15151

Cellular Locus

Cell membrane, Secreted, Single-pass type I membrane protein

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/40kDa/42kDa/45kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5817

Uniprot URL

https://www.uniprot.org/uniprot/P15151

AA Sequence

TCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRNAI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (Biotin)
MBS6171543-01 0.1 mL

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (Biotin)

Sign In for Pricing
View Details
FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (Biotin)
MBS6171543-02 5x 0.1 mL

FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1) (Biotin)

Sign In for Pricing
View Details
CA13 Antibody, HRP conjugated
CSB-PA847613LB01HU-01 50 µg

CA13 Antibody, HRP conjugated

Sign In for Pricing
View Details
CA13 Antibody, HRP conjugated
CSB-PA847613LB01HU-02 100 µg

CA13 Antibody, HRP conjugated

Sign In for Pricing
View Details
Human Serine/threonine-protein kinase TBK1 ELISA Kit
EK3167 Inquire

Human Serine/threonine-protein kinase TBK1 ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain K12) ILVM Polyclonal Antibody
MBS7166049 Inquire

Rabbit anti-Escherichia coli (strain K12) ILVM Polyclonal Antibody

Sign In for Pricing
View Details