Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAB1 Rabbit pAb (APR26070N)

Product Specifications

Background

The protein encoded by this gene was identified as a regulator of the MAP kinase kinase kinase MAP3K7/TAK1, which is known to mediate various intracellular signaling pathways, such as those induced by TGF beta, interleukin 1, and WNT-1. This protein interacts and thus activates TAK1 kinase. It has been shown that the C-terminal portion of this protein is sufficient for binding and activation of TAK1, while a portion of the N-terminus acts as a dominant-negative inhibitor of TGF beta, suggesting that this protein may function as a mediator between TGF beta receptors and TAK1. This protein can also interact with and activate the mitogen-activated protein kinase 14 (MAPK14/p38alpha), and thus represents an alternative activation pathway, in addition to the MAPKK pathways, which contributes to the biological responses of MAPK14 to various stimuli. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TAB1 Rabbit pAb (APR26070N) .

Synonyms

TAB1; 3'-Tab1; MAP3K7IP1

Gene ID

10454

UniProt

Q15750

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa/54kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10454

Uniprot URL

https://www.uniprot.org/uniprot/Q15750

AA Sequence

VDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goat Anti-Human Factor H Complement Polyclonal Antisera
A237 1 mL/Vial

Goat Anti-Human Factor H Complement Polyclonal Antisera

Ask
View Details
Lentiviral human MEIS1 sgRNA gene knockout kit - Lentiviral human MEIS1 sgRNA gene knockout kit (plasmid)
GTR15384389 1 Vial

Lentiviral human MEIS1 sgRNA gene knockout kit - Lentiviral human MEIS1 sgRNA gene knockout kit (plasmid)

Ask
View Details
DUSP23 Mouse Monoclonal Antibody [Clone ID: LBI3C10]
AMM12051V 100 µL

DUSP23 Mouse Monoclonal Antibody [Clone ID: LBI3C10]

Ask
View Details
Anti-Human FADS1/Delta 5 desaturase Antibody (SAA1792)
RHA90801 100 μg

Anti-Human FADS1/Delta 5 desaturase Antibody (SAA1792)

Ask
View Details
Rabbit Phosphotylinosital 3 kinase ELISA Kit
MBS732497-01 48 Well

Rabbit Phosphotylinosital 3 kinase ELISA Kit

Ask
View Details
Rabbit Phosphotylinosital 3 kinase ELISA Kit
MBS732497-02 96 Well

Rabbit Phosphotylinosital 3 kinase ELISA Kit

Ask
View Details