Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNLL1 Rabbit pAb (APR26063N)

Product Specifications

Background

Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DYNLL1 Rabbit pAb (APR26063N) .

Synonyms

DYNLL1; DLC1; DLC8; DNCL1; DNCLC1; LC8; LC8a; PIN; hdlc1

Gene ID

8655

UniProt

P63167

Cellular Locus

Cytoplasm, Mitochondrion, Nucleus, cytoskeleton

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa Observed MW: 13kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8655

Uniprot URL

https://www.uniprot.org/uniprot/P63167

AA Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NM23A Antibody
orb1332465 100 µg

NM23A Antibody

Sign In for Pricing
View Details
Phospho-Glycogen synthase 1 (Ser641) Rabbit Polyclonal Antibody
orb6117-01 50 μL

Phospho-Glycogen synthase 1 (Ser641) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Glycogen synthase 1 (Ser641) Rabbit Polyclonal Antibody
orb6117-02 100 µL

Phospho-Glycogen synthase 1 (Ser641) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Glycogen synthase 1 (Ser641) Rabbit Polyclonal Antibody
orb6117-03 200 µL

Phospho-Glycogen synthase 1 (Ser641) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Caspase 14 (CASP14) Protein
abx065755-01 10 µg

Mouse Caspase 14 (CASP14) Protein

Sign In for Pricing
View Details
Mouse Caspase 14 (CASP14) Protein
abx065755-02 50 µg

Mouse Caspase 14 (CASP14) Protein

Sign In for Pricing
View Details