Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK5 Rabbit pAb (APR26052N)

Product Specifications

Background

This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDK5 Rabbit pAb (APR26052N) .

Synonyms

CDK5; LIS7; PSSALRE

Gene ID

1020

UniProt

Q00535

Cellular Locus

Cell junction, Cell membrane, Cell projection, Cytoplasm, Nucleus, Perikaryon, Peripheral membrane protein, growth cone, lamellipodium, postsynaptic cell membrane, postsynaptic density, synapse

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/33kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1020

Uniprot URL

https://www.uniprot.org/uniprot/Q00535

AA Sequence

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQ domain-containing protein J (IQCJ) Human ELISA Kit
E4421 96 Tests

IQ domain-containing protein J (IQCJ) Human ELISA Kit

Sign In for Pricing
View Details
STAT3 (Signal Transducer and Activator of Transcription 3, Acute-phase Response Factor, APRF) (PE)
S7971-02G 100 Tests

STAT3 (Signal Transducer and Activator of Transcription 3, Acute-phase Response Factor, APRF) (PE)

Sign In for Pricing
View Details
Rat Complement Component 3B ELISA Kit
MBS034246-01 48 Well

Rat Complement Component 3B ELISA Kit

Sign In for Pricing
View Details
Rat Complement Component 3B ELISA Kit
MBS034246-02 96 Well

Rat Complement Component 3B ELISA Kit

Sign In for Pricing
View Details
Rat Complement Component 3B ELISA Kit
MBS034246-03 5x 96 Well

Rat Complement Component 3B ELISA Kit

Sign In for Pricing
View Details
Rat Complement Component 3B ELISA Kit
MBS034246-04 10x 96 Well

Rat Complement Component 3B ELISA Kit

Sign In for Pricing
View Details