Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1A Rabbit pAb (APR26044N)

Product Specifications

Background

This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to the plasma membrane and to recycling vesicles of the early endocytic system. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD1A Rabbit pAb (APR26044N) .

Synonyms

CD1A; CD1; FCB6; HTA1; R4; T6

Gene ID

909

UniProt

P06126

Cellular Locus

Cell membrane, Endosome membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 37kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=909

Uniprot URL

https://www.uniprot.org/uniprot/P06126

AA Sequence

LKEPLSFHVTWIASFYNHSWKQNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLSD

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)
MBS2057993-01 0.1 mL

APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)

Ask
View Details
APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)
MBS2057993-02 0.2 mL

APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)

Ask
View Details
APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)
MBS2057993-03 0.5 mL

APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)

Ask
View Details
APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)
MBS2057993-04 1 mL

APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)

Ask
View Details
APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)
MBS2057993-05 5 mL

APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)

Ask
View Details
APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)
MBS2057993-06 5x 5 mL

APC-Linked Polyclonal Antibody to Fatty Acid Binding Protein 4, Adipocyte (FABP4)

Ask
View Details