Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP53BP2 Rabbit pAb (APR26030N)

Product Specifications

Background

This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TP53BP2 Rabbit pAb (APR26030N) .

Synonyms

TP53BP2; 53BP2; ASPP2; BBP; P53BP2; PPP1R13A

Gene ID

7159

UniProt

Q13625

Cellular Locus

Cytoplasm, Nucleus, perinuclear region

Dilution

IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 111kDa/125kDa/126kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7159

Uniprot URL

https://www.uniprot.org/uniprot/Q13625

AA Sequence

STMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf57 (USB1) Mouse Monoclonal Antibody [Clone ID: OTI1B1]
CF811328 100 µg

C16orf57 (USB1) Mouse Monoclonal Antibody [Clone ID: OTI1B1]

Sign In for Pricing
View Details
Synaptotagmin 1 (SYT1) (NM_001135806) Human Over-expression Lysate
LC427711 20 µg

Synaptotagmin 1 (SYT1) (NM_001135806) Human Over-expression Lysate

Sign In for Pricing
View Details
PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody [Clone ID: OTI3F4]
CF807657 100 µg

PDGF Receptor alpha (PDGFRA) Mouse Monoclonal Antibody [Clone ID: OTI3F4]

Sign In for Pricing
View Details
IL24 Mouse Monoclonal Antibody [Clone ID: OTI4E1]
CF809391 100 µg

IL24 Mouse Monoclonal Antibody [Clone ID: OTI4E1]

Sign In for Pricing
View Details
JNK3 (MAPK10) (NM_138982) Human Over-expression Lysate
LC403373 20 µg

JNK3 (MAPK10) (NM_138982) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZNF146 activation kit by CRISPRa
GA105264 1 Kit

Human ZNF146 activation kit by CRISPRa

Sign In for Pricing
View Details