Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TP53BP2 Rabbit pAb (APR26030N)

Product Specifications

Background

This gene encodes a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. It is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TP53BP2 Rabbit pAb (APR26030N) .

Synonyms

TP53BP2; 53BP2; ASPP2; BBP; P53BP2; PPP1R13A

Gene ID

7159

UniProt

Q13625

Cellular Locus

Cytoplasm, Nucleus, perinuclear region

Dilution

IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 111kDa/125kDa/126kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7159

Uniprot URL

https://www.uniprot.org/uniprot/Q13625

AA Sequence

STMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWSPSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGTLRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLSTVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c Kit (KIT) Rabbit Polyclonal Antibody
AP08062PU-S 50 µL

c Kit (KIT) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MitoViewTM Green, Trial Size
#70054-T 1x 50 µg

MitoViewTM Green, Trial Size

Sign In for Pricing
View Details
FITC-Goat Anti-Rabbit IgG F (ab') 2
RD90769A-01 120 μL

FITC-Goat Anti-Rabbit IgG F (ab') 2

Sign In for Pricing
View Details
FITC-Goat Anti-Rabbit IgG F (ab') 2
RD90769A-02 500 µL

FITC-Goat Anti-Rabbit IgG F (ab') 2

Sign In for Pricing
View Details
FITC-Goat Anti-Rabbit IgG F (ab') 2
RD90769A-03 1 mL

FITC-Goat Anti-Rabbit IgG F (ab') 2

Sign In for Pricing
View Details
Recombinant Human TCN2 Protein (His Tag)
PKSH031522 50 µg

Recombinant Human TCN2 Protein (His Tag)

Sign In for Pricing
View Details