Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRB7 Rabbit pAb (APR26018N)

Product Specifications

Background

The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK) . Several transcript variants encoding two different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GRB7 Rabbit pAb (APR26018N) .

Synonyms

GRB7

Gene ID

2886

UniProt

Q14451

Cellular Locus

Cell junction, Cell membrane, Cell projection, Cytoplasm, Cytoplasmic granule, Cytoplasmic side, Peripheral membrane protein, focal adhesion

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 49kDa/55kDa/59kDa/62kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2886

Uniprot URL

https://www.uniprot.org/uniprot/Q14451

AA Sequence

MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DYKDDDDK Immunomagnetic Beads
EA-IP-001M 1 mL

Anti-DYKDDDDK Immunomagnetic Beads

Sign In for Pricing
View Details
CYP39A1 Polyclonal Antibody
E-AB-14913-01 20 µL

CYP39A1 Polyclonal Antibody

Sign In for Pricing
View Details
CYP39A1 Polyclonal Antibody
E-AB-14913-02 60 µL

CYP39A1 Polyclonal Antibody

Sign In for Pricing
View Details
CYP39A1 Polyclonal Antibody
E-AB-14913-03 120 µL

CYP39A1 Polyclonal Antibody

Sign In for Pricing
View Details
CYP39A1 Polyclonal Antibody
E-AB-14913-04 200 µL

CYP39A1 Polyclonal Antibody

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/2478), CF488A conjugate, 0.1mg/mL
BNC882478-100 1x 100 µL

CD3e (T-Cell Marker) (C3e/2478), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details