Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LEP Rabbit pAb (APR26001N)

Product Specifications

Background

This gene encodes a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LEP Rabbit pAb (APR26001N) .

Synonyms

LEP; LEPD; OB; OBS; leptin

Gene ID

3952

UniProt

P41159

Cellular Locus

Secreted

Dilution

IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3952

Uniprot URL

https://www.uniprot.org/uniprot/P41159

AA Sequence

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KDM2B, CT (Lysine-specific Demethylase 2B, JmjC Domain-containing Histone Demethylation Protein 1B, [Histone-H3]-lysine-36 Demethylase 1B, F-box/LRR-repeat Protein 10, F-box and Leucine-rich Repeat Protein 10, F-box Protein FBL10, Protein JEMMA, Jumonji Domain-containing EMSY-interactor Methyltransferase Motif Protein, CXXC-type Zinc Finger Protein 2, Protein-containing CXXC Domain 2, CXXC2, FBL10, JHDM1B, PCCX2, JHDM1b, FBXL10) (PE) discontinued
K0138-40A-PE 200 µL

KDM2B, CT (Lysine-specific Demethylase 2B, JmjC Domain-containing Histone Demethylation Protein 1B, [Histone-H3]-lysine-36 Demethylase 1B, F-box/LRR-repeat Protein 10, F-box and Leucine-rich Repeat Protein 10, F-box Protein FBL10, Protein JEMMA, Jumonji Domain-containing EMSY-interactor Methyltransferase Motif Protein, CXXC-type Zinc Finger Protein 2, Protein-containing CXXC Domain 2, CXXC2, FBL10, JHDM1B, PCCX2, JHDM1b, FBXL10) (PE) discontinued

Ask
View Details
PE-Linked Polyclonal Antibody to Neuropilin 1 (NRP1)
MBS2046134-01 0.1 mL

PE-Linked Polyclonal Antibody to Neuropilin 1 (NRP1)

Ask
View Details
PE-Linked Polyclonal Antibody to Neuropilin 1 (NRP1)
MBS2046134-02 0.2 mL

PE-Linked Polyclonal Antibody to Neuropilin 1 (NRP1)

Ask
View Details
PE-Linked Polyclonal Antibody to Neuropilin 1 (NRP1)
MBS2046134-03 0.5 mL

PE-Linked Polyclonal Antibody to Neuropilin 1 (NRP1)

Ask
View Details
PE-Linked Polyclonal Antibody to Neuropilin 1 (NRP1)
MBS2046134-04 1 mL

PE-Linked Polyclonal Antibody to Neuropilin 1 (NRP1)

Ask
View Details
PE-Linked Polyclonal Antibody to Neuropilin 1 (NRP1)
MBS2046134-05 5 mL

PE-Linked Polyclonal Antibody to Neuropilin 1 (NRP1)

Ask
View Details