Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPA/PLAT Rabbit pAb (APR25985N)

Product Specifications

Background

This gene encodes tissue-type plasminogen activator, a secreted serine protease that converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. The encoded preproprotein is proteolytically processed by plasmin or trypsin to generate heavy and light chains. These chains associate via disulfide linkages to form the heterodimeric enzyme. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, while decreased activity leads to hypofibrinolysis, which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality tPA/PLAT Rabbit pAb (APR25985N) .

Synonyms

PLAT; T-PA; TPA

Gene ID

5327

UniProt

P00750

Cellular Locus

Secreted, extracellular space

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 32kDa/44kDa/57kDa/62kDa Observed MW: 63kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5327

Uniprot URL

https://www.uniprot.org/uniprot/P00750

AA Sequence

SQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PON1 Antibody
A73307-50UL 50 μL

PON1 Antibody

Sign In for Pricing
View Details
Mouse THY1 Protein, His Tag
E40MOP1350 20 µg

Mouse THY1 Protein, His Tag

Sign In for Pricing
View Details
WDR46 (NM_001164267) Human Tagged Lenti ORF Clone
RC228450L3 10 µg

WDR46 (NM_001164267) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
UBC Protein Lysate (Rat) with C-HA Tag
48943036 100 µg

UBC Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
ABHD14A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV648004 1.0 µg DNA

ABHD14A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
KvLQT1 (Potassium Voltage-gated Channel Subfamily KQT Member 1, KCNQ1, ATFB1, ATFB3, FLJ26167, IKs Producing Slow Voltage-gated Potassium Channel Subunit alpha KvLQT1, JLNS1, KCNA8, KCNA9, KQT-like 1, Kv1.9, Kv7.1, LQT, LQT1, RWS, SQT2, Voltage-gated Potassium Channel Subunit Kv7.1, WRS) (MaxLight 650) discontinued
K9100-10B-ML650 100 µL

KvLQT1 (Potassium Voltage-gated Channel Subfamily KQT Member 1, KCNQ1, ATFB1, ATFB3, FLJ26167, IKs Producing Slow Voltage-gated Potassium Channel Subunit alpha KvLQT1, JLNS1, KCNA8, KCNA9, KQT-like 1, Kv1.9, Kv7.1, LQT, LQT1, RWS, SQT2, Voltage-gated Potassium Channel Subunit Kv7.1, WRS) (MaxLight 650) discontinued

Sign In for Pricing
View Details