Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TPA/PLAT Rabbit pAb (APR25985N)

Product Specifications

Background

This gene encodes tissue-type plasminogen activator, a secreted serine protease that converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. The encoded preproprotein is proteolytically processed by plasmin or trypsin to generate heavy and light chains. These chains associate via disulfide linkages to form the heterodimeric enzyme. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, while decreased activity leads to hypofibrinolysis, which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality tPA/PLAT Rabbit pAb (APR25985N) .

Synonyms

PLAT; T-PA; TPA

Gene ID

5327

UniProt

P00750

Cellular Locus

Secreted, extracellular space

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 32kDa/44kDa/57kDa/62kDa Observed MW: 63kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5327

Uniprot URL

https://www.uniprot.org/uniprot/P00750

AA Sequence

SQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTL Antibody
abx122413-01 100 µg

DTL Antibody

Sign In for Pricing
View Details
DTL Antibody
abx122413-02 1 mg

DTL Antibody

Sign In for Pricing
View Details
01/03/2010 sgRNA CRISPR Lentivector (Human) (Target 2)
K2781603 1.0 µg DNA

01/03/2010 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
D4S234E (NSG1) (NM_014392) Human Over-expression Lysate
LS027065-20ug 20 µg

D4S234E (NSG1) (NM_014392) Human Over-expression Lysate

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 3 (SLC30A3)
MBS2078370-01 0.1 mL

HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 3 (SLC30A3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 3 (SLC30A3)
MBS2078370-02 0.2 mL

HRP-Linked Polyclonal Antibody to Solute Carrier Family 30, Member 3 (SLC30A3)

Sign In for Pricing
View Details