Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OCA2 Rabbit pAb (APR25983N)

Product Specifications

Background

This gene encodes the human homolog of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine, which is a precursor to melanin synthesis. It is involved in mammalian pigmentation, where it may control skin color variation and act as a determinant of brown or blue eye color. Mutations in this gene result in type 2 oculocutaneous albinism. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality OCA2 Rabbit pAb (APR25983N) .

Synonyms

OCA2; BEY; BEY1; BEY2; BOCA; D15S12; EYCL; EYCL2; EYCL3; HCL3; P; PED; SHEP1; P protein

Gene ID

4948

UniProt

Q04671

Cellular Locus

Melanosome membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 74kDa/90kDa/92kDa Observed MW: 65-80kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4948

Uniprot URL

https://www.uniprot.org/uniprot/Q04671

AA Sequence

MHLEGRDGRRYPGAPAVELLQTSVPSGLAELVAGKRRLPRGAGGADPSHSCPRGAAGQSSWAPAGQEFASFLTKGRSHSSLPQMSSSRSKDSCFTENTPLLRNSLQEKGSRCIPVYHPEFITAEESWEDSSADWERRYLLSREVSGLSASASSEKGDLLDSPHIRLRLSKLRRCVQWLKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VGF Human Over-expression Lysate
orb1365807 20 µg

VGF Human Over-expression Lysate

Sign In for Pricing
View Details
Emc1 Mouse siRNA Oligo Duplex (Locus ID 230866)
SR421633 1 Kit

Emc1 Mouse siRNA Oligo Duplex (Locus ID 230866)

Sign In for Pricing
View Details
PSMA2P3 Protein Vector (Human) (pPM-C-HA)
PV113764 500 ng

PSMA2P3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal NCOA3/AIB1 Antibody [PerCP]
NB100-314PCP 0.1 mL

Rabbit Polyclonal NCOA3/AIB1 Antibody [PerCP]

Sign In for Pricing
View Details
PIWIL3 sgRNA CRISPR Lentivector set (Human)
K1654701 3x 1.0 µg

PIWIL3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Myelin Protein P0 (MPZ) Antibody
abx403249-01 100 µL

Myelin Protein P0 (MPZ) Antibody

Sign In for Pricing
View Details