Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9 Rabbit pAb (APR25953N)

Product Specifications

Background

This gene encodes the final component of the complement system. It participates in the formation of the Membrane Attack Complex (MAC) . The MAC assembles on bacterial membranes to form a pore, permitting disruption of bacterial membrane organization. Mutations in this gene cause component C9 deficiency.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality C9 Rabbit pAb (APR25953N) .

Synonyms

C9; ARMD15; C9D

Gene ID

735

UniProt

P02748

Cellular Locus

Cell membrane, Multi-pass membrane protein, Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 63kDa Observed MW: 70kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=735

Uniprot URL

https://www.uniprot.org/uniprot/P02748

AA Sequence

QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)
MBS2121798-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)
MBS2121798-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)
MBS2121798-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)
MBS2121798-04 1 mL

Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)
MBS2121798-05 5 mL

Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)
MBS2121798-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to Gibbon Ape Leukemia Virus Receptor 1 (GLVR1)

Sign In for Pricing
View Details