Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF Receptor 2 Rabbit pAb (APR25943N)

Product Specifications

Background

Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. The signalling and trafficking of this receptor are regulated by multiple factors, including Rab GTPase, P2Y purine nucleotide receptor, integrin alphaVbeta3, T-cell protein tyrosine phosphatase, etc.. Mutations of this gene are implicated in infantile capillary hemangiomas.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VEGF Receptor 2 Rabbit pAb (APR25943N) .

Synonyms

CD309; FLK1; VEGFR; VEGFR2; VEGF Receptor 2; KDR

Gene ID

3791

UniProt

P35968

Cellular Locus

Cell junction, Cell membrane, Cytoplasm, Cytoplasmic vesicle, Early endosome, Endoplasmic reticulum, Nucleus, Secreted, Single-pass type I membrane protein

Applications

IHC (Eoma cell) WB (Eoma cell, HUVEC cells, Mus musculus, Homo sapiens, Rattus norvegicus) IF (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 75kDa/79kDa/151kDa Observed MW: 210KDa/230KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3791

Uniprot URL

https://www.uniprot.org/uniprot/P35968

AA Sequence

RPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma Capricolum rpsH Protein (aa 1-129)
VAng-Lsx06304-50gEcoli 50 µg (E. coli)

Recombinant Mycoplasma Capricolum rpsH Protein (aa 1-129)

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MSH5 Polyclonal Antibody
MBS7190330 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) MSH5 Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-x
307741-01 50 µg

Bcl-x

Sign In for Pricing
View Details
Bcl-x
307741-02 100 µg

Bcl-x

Sign In for Pricing
View Details
JIP1, NT (C-Jun-amino-terminal Kinase-interacting Protein 1, JNK-interacting Protein 1, JIP-1, Islet-brain 1, IB1, IB-1, JNK MAP Kinase Scaffold Protein 1, Mitogen-activated Protein Kinase 8 Interacting Protein 1, MAPK8IP1, PRKM8IP) (MaxLight 750) discontinued
J2499-30B-ML750 100 µL

JIP1, NT (C-Jun-amino-terminal Kinase-interacting Protein 1, JNK-interacting Protein 1, JIP-1, Islet-brain 1, IB1, IB-1, JNK MAP Kinase Scaffold Protein 1, Mitogen-activated Protein Kinase 8 Interacting Protein 1, MAPK8IP1, PRKM8IP) (MaxLight 750) discontinued

Sign In for Pricing
View Details
DIS3L2P 3'UTR GFP Stable Cell Line
TU056034 1.0 mL

DIS3L2P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details