Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF Receptor 2 Rabbit pAb (APR25943N)

Product Specifications

Background

Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. The signalling and trafficking of this receptor are regulated by multiple factors, including Rab GTPase, P2Y purine nucleotide receptor, integrin alphaVbeta3, T-cell protein tyrosine phosphatase, etc.. Mutations of this gene are implicated in infantile capillary hemangiomas.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality VEGF Receptor 2 Rabbit pAb (APR25943N) .

Synonyms

CD309; FLK1; VEGFR; VEGFR2; VEGF Receptor 2; KDR

Gene ID

3791

UniProt

P35968

Cellular Locus

Cell junction, Cell membrane, Cytoplasm, Cytoplasmic vesicle, Early endosome, Endoplasmic reticulum, Nucleus, Secreted, Single-pass type I membrane protein

Applications

IHC (Eoma cell) WB (Eoma cell, HUVEC cells, Mus musculus, Homo sapiens, Rattus norvegicus) IF (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 75kDa/79kDa/151kDa Observed MW: 210KDa/230KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3791

Uniprot URL

https://www.uniprot.org/uniprot/P35968

AA Sequence

RPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HEXIM1, NT (HEXIM1, CLP1, EDG1, HIS1, MAQ1, Protein HEXIM1, Cardiac lineage protein 1, Estrogen down-regulated gene 1 protein, Hexamethylene bis-acetamide-inducible protein 1, Menage a quatre protein 1) (Azide free) (HRP) discontinued
036523-HRP 200 µL

HEXIM1, NT (HEXIM1, CLP1, EDG1, HIS1, MAQ1, Protein HEXIM1, Cardiac lineage protein 1, Estrogen down-regulated gene 1 protein, Hexamethylene bis-acetamide-inducible protein 1, Menage a quatre protein 1) (Azide free) (HRP) discontinued

Ask
View Details
Human Transcription factor GATA 6 (GATA6) ELISA Kit
MBS7217254-01 48 Well

Human Transcription factor GATA 6 (GATA6) ELISA Kit

Ask
View Details
Human Transcription factor GATA 6 (GATA6) ELISA Kit
MBS7217254-02 96 Well

Human Transcription factor GATA 6 (GATA6) ELISA Kit

Ask
View Details
Human Transcription factor GATA 6 (GATA6) ELISA Kit
MBS7217254-03 5x 96 Well

Human Transcription factor GATA 6 (GATA6) ELISA Kit

Ask
View Details
Human Transcription factor GATA 6 (GATA6) ELISA Kit
MBS7217254-04 10x 96 Well

Human Transcription factor GATA 6 (GATA6) ELISA Kit

Ask
View Details
Recombinant RAR Related Orphan Receptor Gamma (RORg)
SIPD283Mu01-01 10 µg

Recombinant RAR Related Orphan Receptor Gamma (RORg)

Ask
View Details