Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FUBP1 Rabbit pAb (APR25932N)

Product Specifications

Background

The protein encoded by this gene is a single stranded DNA-binding protein that binds to multiple DNA elements, including the far upstream element (FUSE) located upstream of c-myc. Binding to FUSE occurs on the non-coding strand, and is important to the regulation of c-myc in undifferentiated cells. This protein contains three domains, an amphipathic helix N-terminal domain, a DNA-binding central domain, and a C-terminal transactivation domain that contains three tyrosine-rich motifs. The N-terminal domain is thought to repress the activity of the C-terminal domain. This protein is also thought to bind RNA, and contains 3'-5' helicase activity with in vitro activity on both DNA-DNA and RNA-RNA duplexes. Aberrant expression of this gene has been found in malignant tissues, and this gene is important to neural system and lung development. Binding of this protein to viral RNA is thought to play a role in several viral diseases, including hepatitis C and hand, foot and mouth disease. Alternative splicing results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FUBP1 Rabbit pAb (APR25932N) .

Synonyms

FUBP1; FBP; FUBP; hDH V; hDHV

Gene ID

8880

UniProt

Q96AE4

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100 IP 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 67kDa/68kDa Observed MW: 79kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8880

Uniprot URL

https://www.uniprot.org/uniprot/Q96AE4

AA Sequence

QNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQGQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Goosecoid Antibody (OTI1D7) [Alexa Fluor 532]
NBP2-72409AF532 0.1 mL

Mouse Monoclonal Goosecoid Antibody (OTI1D7) [Alexa Fluor 532]

Sign In for Pricing
View Details
SR140 ORF Vector (Human) (pORF)
45435011 1.0 µg DNA

SR140 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Shewanella oneidensis Pyridoxine 5'-phosphate synthase (pdxJ)
MBS1383558-01 0.02 mg (E-Coli)

Recombinant Shewanella oneidensis Pyridoxine 5'-phosphate synthase (pdxJ)

Sign In for Pricing
View Details
Recombinant Shewanella oneidensis Pyridoxine 5'-phosphate synthase (pdxJ)
MBS1383558-02 0.1 mg (E-Coli)

Recombinant Shewanella oneidensis Pyridoxine 5'-phosphate synthase (pdxJ)

Sign In for Pricing
View Details
Recombinant Shewanella oneidensis Pyridoxine 5'-phosphate synthase (pdxJ)
MBS1383558-03 0.02 mg (Yeast)

Recombinant Shewanella oneidensis Pyridoxine 5'-phosphate synthase (pdxJ)

Sign In for Pricing
View Details
Recombinant Shewanella oneidensis Pyridoxine 5'-phosphate synthase (pdxJ)
MBS1383558-04 0.1 mg (Yeast)

Recombinant Shewanella oneidensis Pyridoxine 5'-phosphate synthase (pdxJ)

Sign In for Pricing
View Details