Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKR/EIF2AK2 Rabbit pAb (APR25929N)

Product Specifications

Background

The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. Three transcript variants encoding two different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PKR/EIF2AK2 Rabbit pAb (APR25929N) .

Synonyms

EIF2AK1; PKR; PPP1R83; PRKR; Eif2ak2; EIF2AK2

Gene ID

5610

UniProt

P19525

Cellular Locus

Cytoplasm, Nucleus, perinuclear region

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa/62kDa Observed MW: 74kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5610

Uniprot URL

https://www.uniprot.org/uniprot/P19525

AA Sequence

MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETKYTVDKRFGMDFKEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti-mitochondrial antibody (AMA) ELISA KIT
ED0576Hu-01 96 Well

Human Anti-mitochondrial antibody (AMA) ELISA KIT

Sign In for Pricing
View Details
Human Anti-mitochondrial antibody (AMA) ELISA KIT
ED0576Hu-02 5x 96 Tests

Human Anti-mitochondrial antibody (AMA) ELISA KIT

Sign In for Pricing
View Details
Human Anti-mitochondrial antibody (AMA) ELISA KIT
ED0576Hu-03 10x 96 Tests

Human Anti-mitochondrial antibody (AMA) ELISA KIT

Sign In for Pricing
View Details
Human Prominin-1 (PROM1) ELISA Kit
orb1947905-01 48 Tests

Human Prominin-1 (PROM1) ELISA Kit

Sign In for Pricing
View Details
Human Prominin-1 (PROM1) ELISA Kit
orb1947905-02 96 Tests

Human Prominin-1 (PROM1) ELISA Kit

Sign In for Pricing
View Details
DSP Rabbit Polyclonal Antibody
AF6738 50 µL

DSP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details