Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX1A Rabbit pAb (APR25923N)

Product Specifications

Background

This gene encodes a member of the syntaxin superfamily. Syntaxins are nervous system-specific proteins implicated in the docking of synaptic vesicles with the presynaptic plasma membrane. Syntaxins possess a single C-terminal transmembrane domain, a SNARE [Soluble NSF (N-ethylmaleimide-sensitive fusion protein) -Attachment protein REceptor] domain (known as H3), and an N-terminal regulatory domain (Habc) . Syntaxins bind synaptotagmin in a calcium-dependent fashion and interact with voltage dependent calcium and potassium channels via the C-terminal H3 domain. This gene product is a key molecule in ion channel regulation and synaptic exocytosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality STX1A Rabbit pAb (APR25923N) .

Synonyms

STX1A; HPC-1; P35-1; STX1; SYN1A; syntaxin-1A

Gene ID

6804

UniProt

Q16623

Cellular Locus

Cell junction, Cell membrane, Cytoplasmic vesicle, Secreted, Single-pass type IV membrane protein, secretory vesicle, synapse, synaptic vesicle membrane, synaptosome

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa/29kDa/33kDa Observed MW: 33kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6804

Uniprot URL

https://www.uniprot.org/uniprot/Q16623

AA Sequence

MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASTVGGIFA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PPIL1 (Peptidylprolyl Isomerase (cyclophilin) -like 1, CGI-124, CYPL1, MGC678, PPIase, hCyPX) (MaxLight 750) discontinued
250358-ML750 100 µL

PPIL1 (Peptidylprolyl Isomerase (cyclophilin) -like 1, CGI-124, CYPL1, MGC678, PPIase, hCyPX) (MaxLight 750) discontinued

Ask
View Details
Rabbit Polyclonal Bmf Antibody [mFluor Violet 500 SE]
NBP2-97262MFV500 0.1 mL

Rabbit Polyclonal Bmf Antibody [mFluor Violet 500 SE]

Ask
View Details
Troponin T1 (TNNT1) (NM_003283) Human Over-expression Lysate
LY418790 100 µg

Troponin T1 (TNNT1) (NM_003283) Human Over-expression Lysate

Ask
View Details
PAX5/BSAP (Early B-Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone PAX5/3977R]
MBS4382117-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

PAX5/BSAP (Early B-Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone PAX5/3977R]

Ask
View Details
PAX5/BSAP (Early B-Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone PAX5/3977R]
MBS4382117-02 0.1 mg (With BSA & Azide at 0.2mg/mL)

PAX5/BSAP (Early B-Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone PAX5/3977R]

Ask
View Details
PAX5/BSAP (Early B-Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone PAX5/3977R]
MBS4382117-03 0.1 mg (Without BSA & Azide at 1mg/mL)

PAX5/BSAP (Early B-Cell Marker) Recombinant Rabbit Monoclonal Antibody [Clone PAX5/3977R]

Ask
View Details