Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] S100A11 Rabbit pAb (APR25872N)

Product Specifications

Background

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] S100A11 Rabbit pAb (APR25872N) .

Synonyms

S100A11; HEL-S-43; MLN70; S100C

Gene ID

6282

UniProt

P31949

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6282

Uniprot URL

https://www.uniprot.org/uniprot/P31949

AA Sequence

MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Nuphar advena NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic
orb2933318-01 20 µg

Recombinant Nuphar advena NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic

Sign In for Pricing
View Details
Recombinant Nuphar advena NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic
orb2933318-02 100 µg

Recombinant Nuphar advena NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic

Sign In for Pricing
View Details
Morusin
AB0474 20 mg

Morusin

Sign In for Pricing
View Details
V1RL3 Rabbit Polyclonal Antibody
APRab19699-01 20 µL

V1RL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
V1RL3 Rabbit Polyclonal Antibody
APRab19699-02 50 µL

V1RL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
V1RL3 Rabbit Polyclonal Antibody
APRab19699-03 100 µL

V1RL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details