Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFC4 Rabbit pAb (APR25871N)

Product Specifications

Background

The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC) . RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RFC4 Rabbit pAb (APR25871N) .

Synonyms

RFC4; A1; RFC37

Gene ID

5984

UniProt

P35249

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 33kDa/39kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5984

Uniprot URL

https://www.uniprot.org/uniprot/P35249

AA Sequence

DKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLSQNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOAT 1 (SOAT1) (NM_003101) Human Over-expression Lysate
LS006646-100ug 100 µg

SOAT 1 (SOAT1) (NM_003101) Human Over-expression Lysate

Sign In for Pricing
View Details
ARRDC1 (E-6) : m-IgG Fc BP-HRP Bundle
sc-530890 1 Kit

ARRDC1 (E-6) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
COQ2 Protein Vector (Rat) (pPB-N-His)
PV261259 500 ng

COQ2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Tau, 4-repeat isoform RD4 (Tau Protein, Microtubule-associated Protein, MAP)
MBS604301-01 0.2 mL

Tau, 4-repeat isoform RD4 (Tau Protein, Microtubule-associated Protein, MAP)

Sign In for Pricing
View Details
Tau, 4-repeat isoform RD4 (Tau Protein, Microtubule-associated Protein, MAP)
MBS604301-02 5x 0.2 mL

Tau, 4-repeat isoform RD4 (Tau Protein, Microtubule-associated Protein, MAP)

Sign In for Pricing
View Details
Cyclin D1
HAR035-6ml 6 mL

Cyclin D1

Sign In for Pricing
View Details