Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMB2 Rabbit pAb (APR25869N)

Product Specifications

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PSMB2 Rabbit pAb (APR25869N) .

Synonyms

PSMB2; HC7-I

Gene ID

5690

UniProt

P49721

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa Observed MW: 23KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5690

Uniprot URL

https://www.uniprot.org/uniprot/P49721

AA Sequence

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Endothelin Converting Enzyme 1 (ECE1)
TRV-0041445-01 20 µL

Polyclonal Antibody to Endothelin Converting Enzyme 1 (ECE1)

Sign In for Pricing
View Details
Polyclonal Antibody to Endothelin Converting Enzyme 1 (ECE1)
TRV-0041445-02 100 µL

Polyclonal Antibody to Endothelin Converting Enzyme 1 (ECE1)

Sign In for Pricing
View Details
Polyclonal Antibody to Endothelin Converting Enzyme 1 (ECE1)
TRV-0041445-03 200 µL

Polyclonal Antibody to Endothelin Converting Enzyme 1 (ECE1)

Sign In for Pricing
View Details
Polyclonal Antibody to Endothelin Converting Enzyme 1 (ECE1)
TRV-0041445-04 1 mL

Polyclonal Antibody to Endothelin Converting Enzyme 1 (ECE1)

Sign In for Pricing
View Details
Gjb6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
21548116 3x 1.0 µg

Gjb6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Mouse Atp4a Pre-designed siRNA Set B
SI101154B 1 Each

Mouse Atp4a Pre-designed siRNA Set B

Sign In for Pricing
View Details