Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPF3 Rabbit pAb (APR25868N)

Product Specifications

Background

The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors. This gene product is one of several proteins that associate with U4 and U6 snRNPs. Mutations in this gene are associated with retinitis pigmentosa-18.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PRPF3 Rabbit pAb (APR25868N) .

Synonyms

PRPF3; HPRP3; HPRP3P; PRP3; Prp3p; RP18; SNRNP90

Gene ID

9129

UniProt

O43395

Cellular Locus

Nucleus speckle

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/77kDa Observed MW: 100kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9129

Uniprot URL

https://www.uniprot.org/uniprot/O43395

AA Sequence

MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAM1 (NM_032152) Human Recombinant Protein
TP306972M 100 µg

PRAM1 (NM_032152) Human Recombinant Protein

Sign In for Pricing
View Details
C6orf206 (RSPH9) Human qPCR Primer Pair (NM_152732)
HP217930 200 Reactions

C6orf206 (RSPH9) Human qPCR Primer Pair (NM_152732)

Sign In for Pricing
View Details
HEAB (CLP1) (NM_006831) Human Over-expression Lysate
LC402047 20 µg

HEAB (CLP1) (NM_006831) Human Over-expression Lysate

Sign In for Pricing
View Details
Zfp612 Mouse Gene Knockout Kit (CRISPR)
KN519906 1 Kit

Zfp612 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Fibrillarin Monoclonal Antibody
AN301071L-01 50 µL

Recombinant Fibrillarin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Fibrillarin Monoclonal Antibody
AN301071L-02 100 µL

Recombinant Fibrillarin Monoclonal Antibody

Sign In for Pricing
View Details