Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] LITAF Rabbit pAb (APR25856N)

Product Specifications

Background

Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD) . Multiple alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] LITAF Rabbit pAb (APR25856N) .

Synonyms

LITAF; PIG7; SIMPLE; TP53I7

Gene ID

9516

UniProt

Q99732

Cellular Locus

Cytoplasmic side, Lysosome membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IP 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa/17kDa/23kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9516

Uniprot URL

https://www.uniprot.org/uniprot/Q99732

AA Sequence

MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTNA, CT (DTNA, DRP3, Dystrobrevin alpha, Alpha-dystrobrevin, Dystrophin-related protein 3)
MBS6000978-01 0.2 mL

DTNA, CT (DTNA, DRP3, Dystrobrevin alpha, Alpha-dystrobrevin, Dystrophin-related protein 3)

Sign In for Pricing
View Details
DTNA, CT (DTNA, DRP3, Dystrobrevin alpha, Alpha-dystrobrevin, Dystrophin-related protein 3)
MBS6000978-02 5x 0.2 mL

DTNA, CT (DTNA, DRP3, Dystrobrevin alpha, Alpha-dystrobrevin, Dystrophin-related protein 3)

Sign In for Pricing
View Details
Spark Blue™ 550 Rat IgG2b, κ Isotype Ctrl
GT17261 100 µg

Spark Blue™ 550 Rat IgG2b, κ Isotype Ctrl

Sign In for Pricing
View Details
FADD Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-0511R-BF680-01 20 µL

FADD Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
FADD Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-0511R-BF680-02 100 µL

FADD Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
NACA1 Recombinant Protein Antigen
NBP2-57988PEP 100 µL

NACA1 Recombinant Protein Antigen

Sign In for Pricing
View Details