Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PI3 Rabbit pAb (APR25832N)

Product Specifications

Background

This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PI3 Rabbit pAb (APR25832N) .

Synonyms

PI3; ESI; SKALP; WAP3; WFDC14; cementoin; elafin

Gene ID

5266

UniProt

P19957

Cellular Locus

Secreted

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5266

Uniprot URL

https://www.uniprot.org/uniprot/P19957

AA Sequence

AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GRIP1 Antibody [Janelia Fluor 646]
NB120-2842JF646 0.1 mL

Rabbit Polyclonal GRIP1 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Bee Apidaecin 1A Recombinant Protein
RP2081AP 5 µg

Bee Apidaecin 1A Recombinant Protein

Sign In for Pricing
View Details
SMIM23 Rabbit Polyclonal Antibody
TA359050 100 µL

SMIM23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC3A2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV673917 1.0 µg DNA

SLC3A2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human CD181/CD128/CXCR1 Protein, N-GST
orb2968847-01 50 µg

Recombinant Human CD181/CD128/CXCR1 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human CD181/CD128/CXCR1 Protein, N-GST
orb2968847-02 100 µg

Recombinant Human CD181/CD128/CXCR1 Protein, N-GST

Sign In for Pricing
View Details