Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM10 Rabbit pAb (APR25824N)

Product Specifications

Background

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre-RC) and it may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein can interact with MCM2 and MCM6, as well as with the origin recognition protein ORC2. It is regulated by proteolysis and phosphorylation in a cell cycle-dependent manner. Studies of a similar protein in Xenopus suggest that the chromatin binding of this protein at the onset of DNA replication is after pre-RC assembly and before origin unwinding. Alternatively spliced transcript variants encoding distinct isoforms have been identified.

Synonyms

MCM10; CNA43; DNA43; PRO2249

Gene ID

55388

UniProt

Q7L590

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 98kDa Observed MW: 125kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MCM10 Rabbit pAb (APR25824N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=55388

Uniprot URL

https://www.uniprot.org/uniprot/Q7L590

AA Sequence

RLEGAPATMTPKLGRGVLEGDDVLFYDESPPPRPKLSALAEAKKLAAITKLRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEKNTMFSSQAEDELEPARKKRREQLAYLESEEFQKILKAKSKHTGILKEAEAEMQERYFEPLVKKEQMEEKMRNIREVKCRVVTCKTCAYTHFKLLETCVSEQHEYHWHDGVKRFFKCPCGNRSISLDRLPNKHCSNCGLYKWERDGMLKEKTGPKIGGETLLPRGEEHAKFLNSLK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CXXC1, ID (CXXC1, CFP1, CGBP, PCCX1, PHF18, CpG-binding protein, CXXC-type zinc finger protein 1, PHD finger and CXXC domain-containing protein 1) (MaxLight 550)
MBS6290272-01 0.1 mL

CXXC1, ID (CXXC1, CFP1, CGBP, PCCX1, PHF18, CpG-binding protein, CXXC-type zinc finger protein 1, PHD finger and CXXC domain-containing protein 1) (MaxLight 550)

Ask
View Details
CXXC1, ID (CXXC1, CFP1, CGBP, PCCX1, PHF18, CpG-binding protein, CXXC-type zinc finger protein 1, PHD finger and CXXC domain-containing protein 1) (MaxLight 550)
MBS6290272-02 5x 0.1 mL

CXXC1, ID (CXXC1, CFP1, CGBP, PCCX1, PHF18, CpG-binding protein, CXXC-type zinc finger protein 1, PHD finger and CXXC domain-containing protein 1) (MaxLight 550)

Ask
View Details
PLXNA1 Polyclonal Antibody
A52556-100 100 µL

PLXNA1 Polyclonal Antibody

Ask
View Details
Fiz1 (NM_001110330) Mouse Untagged Clone
MC216980 10 µg

Fiz1 (NM_001110330) Mouse Untagged Clone

Ask
View Details
Recombinant Guinea pig Potassium voltage-gated channel subfamily E member 2 (Kcne2)
MBS717652 Inquire

Recombinant Guinea pig Potassium voltage-gated channel subfamily E member 2 (Kcne2)

Ask
View Details
Glucokinase (GCK) (NM_033507) Human Untagged Clone
SC305649 10 µg

Glucokinase (GCK) (NM_033507) Human Untagged Clone

Ask
View Details