Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIB3 Rabbit pAb (APR25821N)

Product Specifications

Background

The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. Differential promoter usage and alternate splicing result in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRIB3 Rabbit pAb (APR25821N) .

Synonyms

TRIB3; C20orf97; NIPK; SINK; SKIP3; TRB3

Gene ID

57761

UniProt

Q96RU7

Cellular Locus

Nucleus

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 35kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57761

Uniprot URL

https://www.uniprot.org/uniprot/Q96RU7

AA Sequence

MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat A Disintegrin And Metalloprotease 6 (ADAM6)
RPU40017-01 50 µg

Recombinant Rat A Disintegrin And Metalloprotease 6 (ADAM6)

Sign In for Pricing
View Details
Recombinant Rat A Disintegrin And Metalloprotease 6 (ADAM6)
RPU40017-02 100 µg

Recombinant Rat A Disintegrin And Metalloprotease 6 (ADAM6)

Sign In for Pricing
View Details
Recombinant Rat A Disintegrin And Metalloprotease 6 (ADAM6)
RPU40017-03 1 mg

Recombinant Rat A Disintegrin And Metalloprotease 6 (ADAM6)

Sign In for Pricing
View Details
Desmin Recombinant Rabbit mAb (SDT-R022)
S0B2062-01 1 mL

Desmin Recombinant Rabbit mAb (SDT-R022)

Sign In for Pricing
View Details
Desmin Recombinant Rabbit mAb (SDT-R022)
S0B2062-02 25 µL

Desmin Recombinant Rabbit mAb (SDT-R022)

Sign In for Pricing
View Details
Desmin Recombinant Rabbit mAb (SDT-R022)
S0B2062-03 100 µL

Desmin Recombinant Rabbit mAb (SDT-R022)

Sign In for Pricing
View Details