Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] CETN2 Rabbit pAb (APR25796N)

Product Specifications

Background

Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] CETN2 Rabbit pAb (APR25796N) .

Synonyms

CETN2; CALT; CEN2; centrin-2

Gene ID

1069

UniProt

P41208

Cellular Locus

Cytoplasm, Nucleus, centriole, centrosome, cytoskeleton, microtubule organizing center

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa Observed MW: 20KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1069

Uniprot URL

https://www.uniprot.org/uniprot/P41208

AA Sequence

MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SPARC Antibody (MM0557-8N38) [Alexa Fluor 750]
NBP2-11913AF750 0.1 mL

Mouse Monoclonal SPARC Antibody (MM0557-8N38) [Alexa Fluor 750]

Sign In for Pricing
View Details
MCF2L Antibody
A52565-50UL 50 μL

MCF2L Antibody

Sign In for Pricing
View Details
pLV3-U6-ME2-shRNA1-EGFP-Puro Plasmid
PVT57556 2 µg

pLV3-U6-ME2-shRNA1-EGFP-Puro Plasmid

Sign In for Pricing
View Details
pENTR223-CDK16 Plasmid
PVT12209 2 µg

pENTR223-CDK16 Plasmid

Sign In for Pricing
View Details
Olfr739 Mouse siRNA Oligo Duplex (Locus ID 258663)
SR409350 1 Kit

Olfr739 Mouse siRNA Oligo Duplex (Locus ID 258663)

Sign In for Pricing
View Details
Rabbit anti GSK 3beta (Ab-216)
AP21301 100 µL

Rabbit anti GSK 3beta (Ab-216)

Sign In for Pricing
View Details