Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD48 Rabbit pAb (APR25795N)

Product Specifications

Background

This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms

CD48; BCM1; BLAST; BLAST1; MEM-102; SLAMF2; hCD48; mCD48

Gene ID

962

UniProt

P09326

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/27kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD48 Rabbit pAb (APR25795N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=962

Uniprot URL

https://www.uniprot.org/uniprot/P09326

AA Sequence

ISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Frozen Tissue Sections, Rectum
CS545115 5x 5 µm

Frozen Tissue Sections, Rectum

Ask
View Details
S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF
MBS6393191-01 0.1 mL

S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF

Ask
View Details
S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF
MBS6393191-02 5x 0.1 mL

S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF

Ask
View Details
Rabbit Polyclonal TCP1-delta Antibody [Alexa Fluor 700]
NBP2-41361AF700 0.1 mL

Rabbit Polyclonal TCP1-delta Antibody [Alexa Fluor 700]

Ask
View Details
Anti-Human GNG2 Polyclonal Antibody
PHF31801 100 μg

Anti-Human GNG2 Polyclonal Antibody

Ask
View Details
4-piperidin-1-yl-3-(piperidin-1-ylsulfonyl)benzoic acid
sc-349717 250 mg

4-piperidin-1-yl-3-(piperidin-1-ylsulfonyl)benzoic acid

Ask
View Details