Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD48 Rabbit pAb (APR25795N)

Product Specifications

Background

This gene encodes a member of the CD2 subfamily of immunoglobulin-like receptors which includes SLAM (signaling lymphocyte activation molecules) proteins. The encoded protein is found on the surface of lymphocytes and other immune cells, dendritic cells and endothelial cells, and participates in activation and differentiation pathways in these cells. The encoded protein does not have a transmembrane domain, however, but is held at the cell surface by a GPI anchor via a C-terminal domain which maybe cleaved to yield a soluble form of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD48 Rabbit pAb (APR25795N) .

Synonyms

CD48; BCM1; BLAST; BLAST1; MEM-102; SLAMF2; hCD48; mCD48

Gene ID

962

UniProt

P09326

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/27kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=962

Uniprot URL

https://www.uniprot.org/uniprot/P09326

AA Sequence

ISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human TPT1 (Translationally-controlled tumor protein) QuickTest ELISA Kit
QT-EH1921 96 Tests

Human TPT1 (Translationally-controlled tumor protein) QuickTest ELISA Kit

Ask
View Details
EBF1 (COE1, Early B Cell factor 1, COE1, EBF, O/E-1, OLF1, Collier, Olf and EBF transcription factor 1, early B Cell factor olfactory neuronal transcription factor 1) (MaxLight 750)
MBS6232609-01 0.1 mL

EBF1 (COE1, Early B Cell factor 1, COE1, EBF, O/E-1, OLF1, Collier, Olf and EBF transcription factor 1, early B Cell factor olfactory neuronal transcription factor 1) (MaxLight 750)

Ask
View Details
EBF1 (COE1, Early B Cell factor 1, COE1, EBF, O/E-1, OLF1, Collier, Olf and EBF transcription factor 1, early B Cell factor olfactory neuronal transcription factor 1) (MaxLight 750)
MBS6232609-02 5x 0.1 mL

EBF1 (COE1, Early B Cell factor 1, COE1, EBF, O/E-1, OLF1, Collier, Olf and EBF transcription factor 1, early B Cell factor olfactory neuronal transcription factor 1) (MaxLight 750)

Ask
View Details
Lentiviral human CCDC91 shRNA (UAS) - Lentiviral human CCDC91 shRNA (UAS, iRFP) plasmid
GTR15324235 1 Vial

Lentiviral human CCDC91 shRNA (UAS) - Lentiviral human CCDC91 shRNA (UAS, iRFP) plasmid

Ask
View Details
MTL5 (Tesmin, Metallothionein-like 5, Testis-specific, Testis-specific Metallothionein-like Protein) (MaxLight 490)
MBS6201954-01 0.1 mL

MTL5 (Tesmin, Metallothionein-like 5, Testis-specific, Testis-specific Metallothionein-like Protein) (MaxLight 490)

Ask
View Details
MTL5 (Tesmin, Metallothionein-like 5, Testis-specific, Testis-specific Metallothionein-like Protein) (MaxLight 490)
MBS6201954-02 5x 0.1 mL

MTL5 (Tesmin, Metallothionein-like 5, Testis-specific, Testis-specific Metallothionein-like Protein) (MaxLight 490)

Ask
View Details