Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMC6 Rabbit pAb (APR25779N)

Product Specifications

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PSMC6 Rabbit pAb (APR25779N) .

Synonyms

PSMC6; CADP44; HEL-S-73; P44; SUG2; p42; ATPase 6

Gene ID

5706

UniProt

P62333

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 44kDa Observed MW: 45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5706

Uniprot URL

https://www.uniprot.org/uniprot/P62333

AA Sequence

DKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)
MBS2131014-01 0.1 mL

Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)

Ask
View Details
Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)
MBS2131014-02 0.2 mL

Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)

Ask
View Details
Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)
MBS2131014-03 0.5 mL

Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)

Ask
View Details
Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)
MBS2131014-04 1 mL

Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)

Ask
View Details
Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)
MBS2131014-05 5 mL

Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)

Ask
View Details
Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)
MBS2131014-06 5x 5 mL

Biotin Linked Monoclonal Antibody to BetaSite APP Cleaving Enzyme 1 (bACE1)

Ask
View Details