Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRM5 Rabbit pAb (APR25769N)

Product Specifications

Background

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The clinical implications of this receptor are unknown; however, stimulation of this receptor is known to increase cyclic AMP levels.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CHRM5 Rabbit pAb (APR25769N) .

Synonyms

CHRM5; HM5

Gene ID

1133

UniProt

P08912

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 60kDa Observed MW: 60KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1133

Uniprot URL

https://www.uniprot.org/uniprot/P08912

AA Sequence

LQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM7 (Proliferation Marker) (MCM7/2832R), CF405S conjugate, 0.1mg/mL
BNC042832-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/2832R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GBGT1 Polyclonal Antibody
E-AB-19900-01 20 µL

GBGT1 Polyclonal Antibody

Sign In for Pricing
View Details
GBGT1 Polyclonal Antibody
E-AB-19900-02 60 µL

GBGT1 Polyclonal Antibody

Sign In for Pricing
View Details
GBGT1 Polyclonal Antibody
E-AB-19900-03 120 µL

GBGT1 Polyclonal Antibody

Sign In for Pricing
View Details
GBGT1 Polyclonal Antibody
E-AB-19900-04 200 µL

GBGT1 Polyclonal Antibody

Sign In for Pricing
View Details
Milk Fat Globulin (EDM45), CF405S conjugate, 0.1mg/mL
BNC040942-500 1x 500 µL

Milk Fat Globulin (EDM45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details