Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GM130 Rabbit pAb (APR25746N)

Product Specifications

Background

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs) . Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein has been postulated to play roles in the stacking of Golgi cisternae and in vesicular transport. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined.

Synonyms

GOLGA2; GM130; golgin A2

Gene ID

2801

UniProt

Q08379

Cellular Locus

Cytoplasm, Golgi apparatus, Peripheral membrane protein, cis-Golgi network membrane, cytoskeleton, spindle pole

Applications

IF (293T, Homo sapiens, Mus musculus) WB (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 70kDa/113kDa Observed MW: 130KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GM130 Rabbit pAb (APR25746N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2801

Uniprot URL

https://www.uniprot.org/uniprot/Q08379

AA Sequence

SKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQLNITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHTQHAARQKEGESEDLASRLQYSRRRVGELERALSAVSTQQKKADRYNKELTKERDALRLEL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ethyl pyrazolo[1,5-a]pyrimidine-6-carboxylate
OR1022126 1 Pack

Ethyl pyrazolo[1,5-a]pyrimidine-6-carboxylate

Ask
View Details
Anti-Phospho-BLNK (Y96) antibody
STJ90847 200 µl

Anti-Phospho-BLNK (Y96) antibody

Ask
View Details
AMFR, ID (AMFR, RNF45, E3 ubiquitin-protein ligase AMFR, Autocrine motility factor receptor, isoform 2, RING finger protein 45, gp78) (Azide free) (HRP)
MBS6273217-01 0.2 mL

AMFR, ID (AMFR, RNF45, E3 ubiquitin-protein ligase AMFR, Autocrine motility factor receptor, isoform 2, RING finger protein 45, gp78) (Azide free) (HRP)

Ask
View Details
AMFR, ID (AMFR, RNF45, E3 ubiquitin-protein ligase AMFR, Autocrine motility factor receptor, isoform 2, RING finger protein 45, gp78) (Azide free) (HRP)
MBS6273217-02 5x 0.2 mL

AMFR, ID (AMFR, RNF45, E3 ubiquitin-protein ligase AMFR, Autocrine motility factor receptor, isoform 2, RING finger protein 45, gp78) (Azide free) (HRP)

Ask
View Details