Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEFA3 Rabbit pAb (APR25742N)

Product Specifications

Background

Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 1 by only one amino acid. This gene and the gene encoding defensin, alpha 1 are both subject to copy number variation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DEFA3 Rabbit pAb (APR25742N) .

Synonyms

DEFA3; DEF3; HNP-3; HNP3; HP-3; HP3

Gene ID

1668

UniProt

P59666

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa Observed MW: 13kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1668

Uniprot URL

https://www.uniprot.org/uniprot/P59666

AA Sequence

EPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTDSP2 Knockout Hela Polyclonal Cells
ARG7809 1 Million

CTDSP2 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Anti-TGF beta Receptor II/TGFBR2 Antibody Picoband®, PE Conjugate
PA1866-PE 100 µg/Vial

Anti-TGF beta Receptor II/TGFBR2 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Phospho-ERK5 (Thr218 + Tyr220) Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2543205 100 µL

Phospho-ERK5 (Thr218 + Tyr220) Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
1- (2- (Phenanthren-9-yl) phenyl) propan-2-one
sc-478546 10 mg

1- (2- (Phenanthren-9-yl) phenyl) propan-2-one

Sign In for Pricing
View Details
HLA Class 2 Antigen DRA, CT (HLA Class II Histocompatibility Antigen DR alpha Chain, HLA-DRA, HLA-DRA1, FLJ51114, MHC Class II Antigen DRA, MLRW) (MaxLight 405)
MBS6480947-01 0.1 mL

HLA Class 2 Antigen DRA, CT (HLA Class II Histocompatibility Antigen DR alpha Chain, HLA-DRA, HLA-DRA1, FLJ51114, MHC Class II Antigen DRA, MLRW) (MaxLight 405)

Sign In for Pricing
View Details
HLA Class 2 Antigen DRA, CT (HLA Class II Histocompatibility Antigen DR alpha Chain, HLA-DRA, HLA-DRA1, FLJ51114, MHC Class II Antigen DRA, MLRW) (MaxLight 405)
MBS6480947-02 5x 0.1 mL

HLA Class 2 Antigen DRA, CT (HLA Class II Histocompatibility Antigen DR alpha Chain, HLA-DRA, HLA-DRA1, FLJ51114, MHC Class II Antigen DRA, MLRW) (MaxLight 405)

Sign In for Pricing
View Details