Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEFA3 Rabbit pAb (APR25742N)

Product Specifications

Background

Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 3, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 1 by only one amino acid. This gene and the gene encoding defensin, alpha 1 are both subject to copy number variation.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality DEFA3 Rabbit pAb (APR25742N) .

Synonyms

DEFA3; DEF3; HNP-3; HNP3; HP-3; HP3

Gene ID

1668

UniProt

P59666

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa Observed MW: 13kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1668

Uniprot URL

https://www.uniprot.org/uniprot/P59666

AA Sequence

EPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ponceau S
PS05 500 ml

Ponceau S

Sign In for Pricing
View Details
PARP16 Knockout HT29 Polyclonal Cells
ARG14444 1 Million

PARP16 Knockout HT29 Polyclonal Cells

Sign In for Pricing
View Details
NOS1 (NM_000620) Human Over-expression Lysate
LH20072V 100 µg

NOS1 (NM_000620) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SIGLECL1 Pre-designed siRNA Set A
SI014783A 1 Each

Human SIGLECL1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
FITM
B1859-5 5 mg

FITM

Sign In for Pricing
View Details
Lentiviral mouse Lamb2 shRNA (UAS) - Lentiviral mouse Lamb2 shRNA (UAS, RFP) plasmid
GTR15109009 1 Vial

Lentiviral mouse Lamb2 shRNA (UAS) - Lentiviral mouse Lamb2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details