Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDRG2 Rabbit pAb (APR25724N)

Product Specifications

Background

This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NDRG2 Rabbit pAb (APR25724N) .

Synonyms

NDRG2; SYLD

Gene ID

57447

UniProt

Q9UN36

Cellular Locus

Cell projection, Cytoplasm, growth cone, perinuclear region

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa/37kDa/39kDa/40kDa Observed MW: 36kDa/41kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=57447

Uniprot URL

https://www.uniprot.org/uniprot/Q9UN36

AA Sequence

LARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RERGL Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
38827066 1.0 µg DNA

RERGL Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Ask
View Details
Rilpivirine (Reverse Transcriptase inhibitor)
SD8486-5mg 5 mg

Rilpivirine (Reverse Transcriptase inhibitor)

Ask
View Details
Macrophage Inflammatory Protein 5, aa34-49 (CCL15, chemokine (C-C motif) ligand 15, C-C motif chemokine 15, Chemokine CC-2, HCC-2, HMRP-2B, Leukotactin-1, LKN1, Lkn-1, LKN-1, Macrophage inflammatory protein 5, MIP-1d, MIP-1 delta, MIP5, MIP-5, Mrp-2b, NCC3, NCC-3, SCYA15, SCYL3, Small-inducible cytokine A15, SY15) (Not for Export EU)
M1202-72H-01 20 µL

Macrophage Inflammatory Protein 5, aa34-49 (CCL15, chemokine (C-C motif) ligand 15, C-C motif chemokine 15, Chemokine CC-2, HCC-2, HMRP-2B, Leukotactin-1, LKN1, Lkn-1, LKN-1, Macrophage inflammatory protein 5, MIP-1d, MIP-1 delta, MIP5, MIP-5, Mrp-2b, NCC3, NCC-3, SCYA15, SCYL3, Small-inducible cytokine A15, SY15) (Not for Export EU)

Ask
View Details
Macrophage Inflammatory Protein 5, aa34-49 (CCL15, chemokine (C-C motif) ligand 15, C-C motif chemokine 15, Chemokine CC-2, HCC-2, HMRP-2B, Leukotactin-1, LKN1, Lkn-1, LKN-1, Macrophage inflammatory protein 5, MIP-1d, MIP-1 delta, MIP5, MIP-5, Mrp-2b, NCC3, NCC-3, SCYA15, SCYL3, Small-inducible cytokine A15, SY15) (Not for Export EU)
M1202-72H-02 100 µL

Macrophage Inflammatory Protein 5, aa34-49 (CCL15, chemokine (C-C motif) ligand 15, C-C motif chemokine 15, Chemokine CC-2, HCC-2, HMRP-2B, Leukotactin-1, LKN1, Lkn-1, LKN-1, Macrophage inflammatory protein 5, MIP-1d, MIP-1 delta, MIP5, MIP-5, Mrp-2b, NCC3, NCC-3, SCYA15, SCYL3, Small-inducible cytokine A15, SY15) (Not for Export EU)

Ask
View Details
BSG, ID (BSG, Basigin, 5F7, Collagenase stimulatory factor, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6, OK blood group antigen, Tumor cell-derived collagenase stimulatory factor, CD147) (APC) discontinued
032597-APC 200 µL

BSG, ID (BSG, Basigin, 5F7, Collagenase stimulatory factor, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6, OK blood group antigen, Tumor cell-derived collagenase stimulatory factor, CD147) (APC) discontinued

Ask
View Details
THI2.1 (Biotin)
578926-01 50 µg

THI2.1 (Biotin)

Ask
View Details